Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL4 protein (Active)

This Mouse CCL4 protein (Active) spans the amino acid sequence from region 24-92aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Immune activation protein 2, ACT2, Macrophage inflammatory protein 1-beta, MIP-1-beta, Protein H400

UniProt

P14097

Expression Region

24-92aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 20-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 2X PBS, pH 7.4

AA Sequence

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal OX40/TNFRSF4 Antibody (cudarolimab) [Janelia Fluor 585]
NBP3-28285JF585 0.1 mL

Human Monoclonal OX40/TNFRSF4 Antibody (cudarolimab) [Janelia Fluor 585]

Sign In for Pricing
View Details
Live Bacterial Gram Stain Kit - 200 assays
#32000-1 1 Kit

Live Bacterial Gram Stain Kit - 200 assays

Sign In for Pricing
View Details
Rabbit Polyclonal Monkeypox Virus B21R Antibody [PE]
NBP3-26105PE 0.1 mL

Rabbit Polyclonal Monkeypox Virus B21R Antibody [PE]

Sign In for Pricing
View Details
ELOVL5 Antibody - N-terminal region
ARP49667_P050-25UL 25 µL

ELOVL5 Antibody - N-terminal region

Sign In for Pricing
View Details
Human RGL3 qPCR Primer Pair
QH47473S 200 Tests

Human RGL3 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi B Protein FdhE (fdhE)
MBS1059212-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi B Protein FdhE (fdhE)

Sign In for Pricing
View Details