Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL3 protein (Active)

This Mouse CCL3 protein (Active) spans the amino acid sequence from region 24-92aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Heparin-binding chemotaxis protein, Macrophage inflammatory protein 1-alpha, MIP-1-alpha, SIS-alpha, Small-inducible cytokine A3

UniProt

P10855

Expression Region

24-92aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using murine splenocytes is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA

AA Sequence

APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Znrf3 (NM_001080924) Mouse Tagged ORF Clone Lentiviral Particle
MR215754L3V 200 µL

Znrf3 (NM_001080924) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MAPK3 Antibody
orb675542-01 50 µg

MAPK3 Antibody

Sign In for Pricing
View Details
MAPK3 Antibody
orb675542-02 100 µg

MAPK3 Antibody

Sign In for Pricing
View Details
PRELP Recombinant Protein (Human)
RP024550 100 µg

PRELP Recombinant Protein (Human)

Sign In for Pricing
View Details
Human ZNF23 Protein Lysate
MBS8430200-01 0.02 mg

Human ZNF23 Protein Lysate

Sign In for Pricing
View Details
Human ZNF23 Protein Lysate
MBS8430200-02 5x 0.02 mg

Human ZNF23 Protein Lysate

Sign In for Pricing
View Details