Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse X3CL1 protein (Active)

This Mouse X3CL1 protein (Active) spans the amino acid sequence from region 25-100aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-X3-C motif chemokine 1, Neurotactin, Small-inducible cytokine D1,

UniProt

O35188

Expression Region

25-100aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human peripheral blood lymphocytes (PBL) is less than 0.5 μg/ml, corresponding to a specific activity of > 2000 IU/mg.

Form

Lyophilized powder

Molecular Weight

8.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FAZF / TZFP / ZBTB32 antibody
STJ70435 100 µg

Anti-FAZF / TZFP / ZBTB32 antibody

Sign In for Pricing
View Details
C1orf137 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0213106 1.0 µg DNA

C1orf137 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Col1a1 Rat Pre-designed siRNA Set A
HY-RS23404 1 Set

Col1a1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
N-Hydroxyphthalimide
165424 25 g

N-Hydroxyphthalimide

Sign In for Pricing
View Details
Mfap1a Protein Vector (Mouse) (pPB-N-His)
PV200487 500 ng

Mfap1a Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Gremubamab ELISA Kit
E55K0595 96 Tests

Gremubamab ELISA Kit

Sign In for Pricing
View Details