Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse X3CL1 protein (Active)

This Mouse X3CL1 protein (Active) spans the amino acid sequence from region 25-100aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-X3-C motif chemokine 1, Neurotactin, Small-inducible cytokine D1,

UniProt

O35188

Expression Region

25-100aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human peripheral blood lymphocytes (PBL) is less than 0.5 μg/ml, corresponding to a specific activity of > 2000 IU/mg.

Form

Lyophilized powder

Molecular Weight

8.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBV p18 Protein
orb611048-01 100 µg

EBV p18 Protein

Sign In for Pricing
View Details
EBV p18 Protein
orb611048-02 0.5 mg

EBV p18 Protein

Sign In for Pricing
View Details
EBV p18 Protein
orb611048-03 1 mg

EBV p18 Protein

Sign In for Pricing
View Details
PLEK antibody
MBS838324-01 0.1 mL

PLEK antibody

Sign In for Pricing
View Details
PLEK antibody
MBS838324-02 5x 0.1 mL

PLEK antibody

Sign In for Pricing
View Details
Bovine Mannose-binding protein C (MBL) ELISA Kit
RK08198 96 Tests

Bovine Mannose-binding protein C (MBL) ELISA Kit

Sign In for Pricing
View Details