Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CXL16 protein (Active)

This Mouse CXL16 protein (Active) spans the amino acid sequence from region 27-114aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein, Small-inducible cytokine B16, Transmembrane chemokine CXCL16

UniProt

Q8BSU2

Expression Region

27-114aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine lymphocytes is in a concentration of 20-1000 ng/ml.

Form

Lyophilized powder

Molecular Weight

9.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (MaxLight 650)
MBS6256395-01 0.1 mL

TNF alpha (MaxLight 650)

Sign In for Pricing
View Details
TNF alpha (MaxLight 650)
MBS6256395-02 5x 0.1 mL

TNF alpha (MaxLight 650)

Sign In for Pricing
View Details
Recombinant R-Spondin 1 (RSPO1)
TRV-0011360-01 10 µg

Recombinant R-Spondin 1 (RSPO1)

Sign In for Pricing
View Details
Recombinant R-Spondin 1 (RSPO1)
TRV-0011360-02 50 µg

Recombinant R-Spondin 1 (RSPO1)

Sign In for Pricing
View Details
Recombinant R-Spondin 1 (RSPO1)
TRV-0011360-03 100 µg

Recombinant R-Spondin 1 (RSPO1)

Sign In for Pricing
View Details
Recombinant R-Spondin 1 (RSPO1)
TRV-0011360-04 200 µg

Recombinant R-Spondin 1 (RSPO1)

Sign In for Pricing
View Details