Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial

This Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial spans the amino acid sequence from region 574-689aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Na (+) -dependent phosphate cotransporter 2BNaPi3bSodium/phosphate cotransporter 2B , Na (+) /Pi cotransporter 2B , NaPi-2bSolute carrier family 34 member 2

UniProt

O95436

Expression Region

574-689aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein E (APOE) Human Gene Knockout Kit (CRISPR)
KN200395RB 1 Kit

Apolipoprotein E (APOE) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB547945 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2492), CF640R conjugate, 0.1mg/mL
BNC402492-500 1x 500 µL

ATG5 (Autophagy Marker) (ATG5/2492), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-Hyodeoxycholic Acid
TRC-H998105-5MG 5 mg

Beta-Hyodeoxycholic Acid

Sign In for Pricing
View Details
Clcnkb Mouse Gene Knockout Kit (CRISPR)
KN503399 1 Kit

Clcnkb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ankrd40 Mouse Gene Knockout Kit (CRISPR)
KN501290 1 Kit

Ankrd40 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details