Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD94 Recombinant Protein

CD94 Recombinant Protein

Product Specifications

UniProt

Q13241

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~19kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

KNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCAS QKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKN CIAYNPNGNALDESCEDKNRYICKQQLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAK1 (Phospho-Tyr1022) Antibody
RDSA62147 100 µL

JAK1 (Phospho-Tyr1022) Antibody

Sign In for Pricing
View Details
Mouse homing associated cell adhesion molecule (HCAM / CD44) ELISA Kit
MBS268584-01 48 Well

Mouse homing associated cell adhesion molecule (HCAM / CD44) ELISA Kit

Sign In for Pricing
View Details
Mouse homing associated cell adhesion molecule (HCAM / CD44) ELISA Kit
MBS268584-02 96 Well

Mouse homing associated cell adhesion molecule (HCAM / CD44) ELISA Kit

Sign In for Pricing
View Details
Mouse homing associated cell adhesion molecule (HCAM / CD44) ELISA Kit
MBS268584-03 5x 96 Well

Mouse homing associated cell adhesion molecule (HCAM / CD44) ELISA Kit

Sign In for Pricing
View Details
Mouse homing associated cell adhesion molecule (HCAM / CD44) ELISA Kit
MBS268584-04 10x 96 Well

Mouse homing associated cell adhesion molecule (HCAM / CD44) ELISA Kit

Sign In for Pricing
View Details
VSIG4 Recombinant Protein
orb1228982 0.05 mg

VSIG4 Recombinant Protein

Sign In for Pricing
View Details