Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD94 Recombinant Protein

CD94 Recombinant Protein

Product Specifications

UniProt

Q13241

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~19kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

KNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCAS QKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKN CIAYNPNGNALDESCEDKNRYICKQQLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB) (PE)
MBS6187817-01 0.1 mL

RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB) (PE)

Sign In for Pricing
View Details
RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB) (PE)
MBS6187817-02 5x 0.1 mL

RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB) (PE)

Sign In for Pricing
View Details
Anti-MRC1/Cd206 Rabbit Monoclonal Antibody
M02285 100 µL/Vial

Anti-MRC1/Cd206 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Poliovirus Receptor/PVR Rabbit Polyclonal Antibody (APC)
orb2602223 100 µg

Poliovirus Receptor/PVR Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Human GPR45 Protein, hFc Tag
orb3123980-01 10 µg

Human GPR45 Protein, hFc Tag

Sign In for Pricing
View Details
Human GPR45 Protein, hFc Tag
orb3123980-02 50 µg

Human GPR45 Protein, hFc Tag

Sign In for Pricing
View Details