Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PEX19 protein

This Human PEX19 protein spans the amino acid sequence from region 2-296aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

33 kDa housekeeping protein Peroxin-19 Peroxisomal farnesylated protein

UniProt

P40855

Expression Region

2-296aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/ml can bind human PEX19, the EC50 of human PEX19 protein is 22.96-33.00 μg/ml.

Form

Liquid or Lyophilized powder

Molecular Weight

59.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF114 Antibody - C-terminal region : Biotin (ARP36221_P050-Biotin)
ARP36221_P050-Biotin 100 µL

ZNF114 Antibody - C-terminal region : Biotin (ARP36221_P050-Biotin)

Sign In for Pricing
View Details
MLTK Antibody
MBS9404516-01 0.05 mL

MLTK Antibody

Sign In for Pricing
View Details
MLTK Antibody
MBS9404516-02 0.1 mL

MLTK Antibody

Sign In for Pricing
View Details
MLTK Antibody
MBS9404516-03 5x 0.1 mL

MLTK Antibody

Sign In for Pricing
View Details
Ccdc13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4324208 1.0 µg DNA

Ccdc13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
HER2 monoclonal antibody
MB66074 50ul

HER2 monoclonal antibody

Sign In for Pricing
View Details