Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tpp2 protein

This Mouse Tpp2 protein spans the amino acid sequence from region 44-264aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tripeptidyl aminopeptidase (Tripeptidyl-peptidase II) (TPP-II)

UniProt

Q64514

Expression Region

44-264aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHD Antibody
MBS9506937-01 0.05 mL

SHD Antibody

Sign In for Pricing
View Details
SHD Antibody
MBS9506937-02 0.1 mL

SHD Antibody

Sign In for Pricing
View Details
SHD Antibody
MBS9506937-03 5x 0.1 mL

SHD Antibody

Sign In for Pricing
View Details
A2LD1-set siRNA/shRNA/RNAi Lentivector (Human)
10926091 4x 500 ng

A2LD1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
ZNF484 CRISPR/Cas9 KO Plasmid (h)
sc-418091 20 µg

ZNF484 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
NCAM1 Protein, Rat, Recombinant (His)
TMPY-03874-01 5 µg

NCAM1 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details