Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Stfa1 protein

This Mouse Stfa1 protein spans the amino acid sequence from region 1-97aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stfa1, Stf-1, Stf1Stefin-1

UniProt

P35175

Expression Region

1-97aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLGGVSEASRATPEIQMIANKVRPQLEAKTNKKYEKFEAVEYKTQVVAGENIFIKMDVGHGCFIHIKVFNGPTGKDNYELHGYQTDKTMDEELTYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4ORF28 (PACRGL) (NM_145048) Human Tagged Lenti ORF Clone
RC205767L3 10 µg

C4ORF28 (PACRGL) (NM_145048) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human Nuclear transcription factor Y subunit beta Protein, GST, E.coli-1mg
QP6417-ec-1mg 1mg

Recombinant Human Nuclear transcription factor Y subunit beta Protein, GST, E.coli-1mg

Sign In for Pricing
View Details
S100 alpha 6 (S100A6) (NM_014624) Human Tagged ORF Clone Lentiviral Particle
RC203951L2V 200 µL

S100 alpha 6 (S100A6) (NM_014624) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human (Cho cells) recombinant, purified BMP7 protein Western blot +ve control
BMP71-C 100 µL

Human (Cho cells) recombinant, purified BMP7 protein Western blot +ve control

Sign In for Pricing
View Details
SR (1H4)
sc-13509 200 µg/mL

SR (1H4)

Sign In for Pricing
View Details
Mouse Zc3h7b Pre-designed siRNA Set A
SI116278A 1 Each

Mouse Zc3h7b Pre-designed siRNA Set A

Sign In for Pricing
View Details