Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Stfa1 protein

This Mouse Stfa1 protein spans the amino acid sequence from region 1-97aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stfa1, Stf-1, Stf1Stefin-1

UniProt

P35175

Expression Region

1-97aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLGGVSEASRATPEIQMIANKVRPQLEAKTNKKYEKFEAVEYKTQVVAGENIFIKMDVGHGCFIHIKVFNGPTGKDNYELHGYQTDKTMDEELTYF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sauvagin Rabbit pAb, Pacific Blue conjugated
orb2849332 100 µL

Sauvagin Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
IPO8 Protein Vector (Human) (pPM-C-HA)
PV087772 500 ng

IPO8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
APBA1 discontinued
306307 100 µL

APBA1 discontinued

Sign In for Pricing
View Details
Dog Collagen Type I Alpha 2 (COL1a2) ELISA Kit
MBS2701495-01 24 Strip Well

Dog Collagen Type I Alpha 2 (COL1a2) ELISA Kit

Sign In for Pricing
View Details
Dog Collagen Type I Alpha 2 (COL1a2) ELISA Kit
MBS2701495-02 48 Well

Dog Collagen Type I Alpha 2 (COL1a2) ELISA Kit

Sign In for Pricing
View Details
Dog Collagen Type I Alpha 2 (COL1a2) ELISA Kit
MBS2701495-03 96 Well

Dog Collagen Type I Alpha 2 (COL1a2) ELISA Kit

Sign In for Pricing
View Details