Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tead4 protein

This Mouse Tead4 protein spans the amino acid sequence from region 210-427aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ETF-related factor 2 (ETFR-2) (TEA domain family member 4) (TEAD-4) (TEF-1-related factor 1) (TEF-1-related factor FR-19) (RTEF-1)

UniProt

Q62296

Expression Region

210-427aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASIC5 Rabbit Polyclonal Antibody
orb3071713-01 30 µL

ASIC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASIC5 Rabbit Polyclonal Antibody
orb3071713-02 50 µL

ASIC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASIC5 Rabbit Polyclonal Antibody
orb3071713-03 100 µL

ASIC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASIC5 Rabbit Polyclonal Antibody
orb3071713-04 200 µL

ASIC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclic inosine diphosphate ribose (N¹-cIDPR), sodium salt
C 098-005 0.5 µmol ~ 271 µg

Cyclic inosine diphosphate ribose (N¹-cIDPR), sodium salt

Sign In for Pricing
View Details
LCN8 Peptide - N-terminal region
orb2012199 100 µg

LCN8 Peptide - N-terminal region

Sign In for Pricing
View Details