Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ITGBL1 protein

This Human ITGBL1 protein spans the amino acid sequence from region 24-494aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Osteoblast-specific cysteine-rich protein (Ten integrin EGF-like repeat domain-containing protein)

UniProt

O95965

Expression Region

24-494aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QuantiChrom™ Plasmin Assay Kit
DPLM-100 100 Tests

QuantiChrom™ Plasmin Assay Kit

Sign In for Pricing
View Details
PCB-153-13C12
TRC-P216503-5MG 5 mg

PCB-153-13C12

Sign In for Pricing
View Details
CDC42 (NM_001791) Human Over-expression Lysate
LC400679 20 µg

CDC42 (NM_001791) Human Over-expression Lysate

Sign In for Pricing
View Details
KChIP1 Rabbit Polyclonal Antibody
ER1902-17 100 µL

KChIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PIGC Human Gene Knockout Kit (CRISPR)
KN400611 1 Kit

PIGC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human QPCTL activation kit by CRISPRa
GA110281 1 Kit

Human QPCTL activation kit by CRISPRa

Sign In for Pricing
View Details