Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF13C protein

This Human TNFRSF13C protein spans the amino acid sequence from region 7-71aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q96RJ3

Expression Region

7-71aa

Tag

C-terminal hFc1-Flag-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 μg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml. 2Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B, the EC50 is 0.2699-0.5613 ng/ml.

Form

Lyophilized powder

Molecular Weight

36.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α-actinin-3 CRISPR Activation Plasmid (m2)
sc-418972-ACT-2 20 µg

α-actinin-3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
NT5E siRNA Oligos set (Human)
32232171 3x 5 nmol

NT5E siRNA Oligos set (Human)

Sign In for Pricing
View Details
VEPH1 Antibody
orb2680539-01 50 µL

VEPH1 Antibody

Sign In for Pricing
View Details
VEPH1 Antibody
orb2680539-02 100 µL

VEPH1 Antibody

Sign In for Pricing
View Details
VEPH1 Antibody
orb2680539-03 200 µL

VEPH1 Antibody

Sign In for Pricing
View Details
FCGR1A Rabbit mAb Antibody
orb3015453 100 µL

FCGR1A Rabbit mAb Antibody

Sign In for Pricing
View Details