Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GPX5 protein

This Human GPX5 protein spans the amino acid sequence from region 1-100aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymis-specific glutathione peroxidase-like protein

UniProt

O75715

Expression Region

1-100aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSBP1 (NM_001537) Human Over-expression Lysate
LC419869 20 µg

HSBP1 (NM_001537) Human Over-expression Lysate

Sign In for Pricing
View Details
Chicken UPA ELISA Kit
ECKU0019 96 Tests

Chicken UPA ELISA Kit

Sign In for Pricing
View Details
Phospho-IRF3 (Ser396) Rabbit Polyclonal Antibody
AF5848 50 µL

Phospho-IRF3 (Ser396) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Delta 4 (Delta-like Protein 4, DLL4, Drosophila Delta Homolog 4, Notch Ligand DLL4 Precursor, hdelta2)
030145 100 µL

Delta 4 (Delta-like Protein 4, DLL4, Drosophila Delta Homolog 4, Notch Ligand DLL4 Precursor, hdelta2)

Sign In for Pricing
View Details
Rabbit Tyrosinase-Related Protein 2, TYRP2 ELISA KIT
E0300Rb-01 48 Well

Rabbit Tyrosinase-Related Protein 2, TYRP2 ELISA KIT

Sign In for Pricing
View Details
Rabbit Tyrosinase-Related Protein 2, TYRP2 ELISA KIT
E0300Rb-02 96 Well

Rabbit Tyrosinase-Related Protein 2, TYRP2 ELISA KIT

Sign In for Pricing
View Details