Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL protein

This PRL protein spans the amino acid sequence from region 31-229aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PRL

UniProt

P12420

Expression Region

31-229aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Equus caballus (Horse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPICPSGAVNCQVSLRELFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFVTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPEAILSKAIEIEEQNRRLLEGMEKIVGQVQPRIKENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB11 Recombinant Protein Antigen
NBP2-68605PEP 100 µL

PSMB11 Recombinant Protein Antigen

Sign In for Pricing
View Details
Ckap2l 3'UTR Lenti-reporter-Luc Vector
16212084 1.0 µg

Ckap2l 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Prolactin Induced Protein (PIP)
MBS2083554-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Prolactin Induced Protein (PIP)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Prolactin Induced Protein (PIP)
MBS2083554-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Prolactin Induced Protein (PIP)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Prolactin Induced Protein (PIP)
MBS2083554-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Prolactin Induced Protein (PIP)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Prolactin Induced Protein (PIP)
MBS2083554-04 1 mL

Cy3-Linked Polyclonal Antibody to Prolactin Induced Protein (PIP)

Sign In for Pricing
View Details