Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enterobacteria phage T4 Single-stranded DNA-binding protein

This Enterobacteria phage T4 Single-stranded DNA-binding protein spans the amino acid sequence from region 1-301aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gp32; Helix-destabilizing protein

UniProt

P03695

Expression Region

1-301aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR5693 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV733451 1.0 µg DNA

MIR5693 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
AHCYL2 Protein Vector (Human) (pPM-C-His)
PV061572 500 ng

AHCYL2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ANGPTL8 Antibody
orb238763-01 50 µg

ANGPTL8 Antibody

Sign In for Pricing
View Details
ANGPTL8 Antibody
orb238763-02 100 µg

ANGPTL8 Antibody

Sign In for Pricing
View Details
Rat Amino-Terminal Enhancer Of Split (AES) ELISA Kit
abx390970 96 Tests

Rat Amino-Terminal Enhancer Of Split (AES) ELISA Kit

Sign In for Pricing
View Details
UBE2V1 (Ubiquitin-conjugating Enzyme E2 variant 1, CIR1, CROC-1, CROC1, UBE2V, UEV-1, UEV1, UEV1A)
253221 50 µL

UBE2V1 (Ubiquitin-conjugating Enzyme E2 variant 1, CIR1, CROC-1, CROC1, UBE2V, UEV-1, UEV1, UEV1A)

Sign In for Pricing
View Details