Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enterobacteria phage T4 Single-stranded DNA-binding protein

This Enterobacteria phage T4 Single-stranded DNA-binding protein spans the amino acid sequence from region 1-301aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gp32; Helix-destabilizing protein

UniProt

P03695

Expression Region

1-301aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SPOP Protein, His (Fc)-Avi-tagged
SPOP-2088H 50 µg

Recombinant Human SPOP Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Zamaporvint (RXC004)
E1486-5mg 5 mg

Zamaporvint (RXC004)

Sign In for Pricing
View Details
NNMT Peptide
orb1234810 0.1 mg

NNMT Peptide

Sign In for Pricing
View Details
MRE11 Polyclonal Antibody
ABP55270-01 30 µL

MRE11 Polyclonal Antibody

Sign In for Pricing
View Details
MRE11 Polyclonal Antibody
ABP55270-02 50 µL

MRE11 Polyclonal Antibody

Sign In for Pricing
View Details
MRE11 Polyclonal Antibody
ABP55270-03 100 µL

MRE11 Polyclonal Antibody

Sign In for Pricing
View Details