Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP15 protein

This Human BMP15 protein spans the amino acid sequence from region 268-392aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth/differentiation factor 9B

UniProt

O95972

Expression Region

268-392aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTAGE5 discontinued
312245 100 µL

CTAGE5 discontinued

Sign In for Pricing
View Details
PLV3-CMV-NAT10 (human) -3xFLAG-CopGFP-Puro
BZ54101 1 Vial

PLV3-CMV-NAT10 (human) -3xFLAG-CopGFP-Puro

Sign In for Pricing
View Details
EIF2AP3 Protein Vector (Human) (pPB-N-His)
PV075118 500 ng

EIF2AP3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
SLC6A1 Protein Vector (Human) (pPB-N-His)
PV038978 500 ng

SLC6A1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Omnimabs® Protein G IP (Co-IP) Kit (Magarose)
OM643441 1 Kit

Omnimabs® Protein G IP (Co-IP) Kit (Magarose)

Sign In for Pricing
View Details
HIGD1A (NM_014056) Human Over-expression Lysate
LS025994 100 µg

HIGD1A (NM_014056) Human Over-expression Lysate

Sign In for Pricing
View Details