Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BARF1 protein

This BARF1 protein spans the amino acid sequence from region 21-221aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

33 kDa early protein p33

UniProt

P0CW72

Expression Region

21-221aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB11FIP4 Protein Vector (Rat) (pPM-C-His)
PV297661 500 ng

RAB11FIP4 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
2-Amino-4-[ (3,4-diaminophenyl) sulfonyl]phenylamine
sc-298247 100 mg

2-Amino-4-[ (3,4-diaminophenyl) sulfonyl]phenylamine

Sign In for Pricing
View Details
Human cytokeratin 19, CK-19 ELISA Kit
CK-bio-11167-01 48 Tests

Human cytokeratin 19, CK-19 ELISA Kit

Sign In for Pricing
View Details
Human cytokeratin 19, CK-19 ELISA Kit
CK-bio-11167-02 96 Tests

Human cytokeratin 19, CK-19 ELISA Kit

Sign In for Pricing
View Details
Human cytokeratin 19, CK-19 ELISA Kit
CK-bio-11167-03 5x 96 Tests

Human cytokeratin 19, CK-19 ELISA Kit

Sign In for Pricing
View Details
Human cytokeratin 19, CK-19 ELISA Kit
CK-bio-11167-04 10x 96 Tests

Human cytokeratin 19, CK-19 ELISA Kit

Sign In for Pricing
View Details