Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BARF1 protein

This BARF1 protein spans the amino acid sequence from region 21-221aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

33 kDa early protein p33

UniProt

P0CW72

Expression Region

21-221aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Beta TRCP (BTRC) (NM_001256856) AAV Particle
RC232989A1V 250 µL

Human Beta TRCP (BTRC) (NM_001256856) AAV Particle

Sign In for Pricing
View Details
Transcription factor SOX-2 Polyclonal Conjugated Antibody
orb1617611 100 µL

Transcription factor SOX-2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Insulin-Like Growth Factor I Receptor, alpha (IGF1Ra) (BSA & Azide Free) (MaxLight 405) discontinued
I7661-21FX-ML405 100 µL

Insulin-Like Growth Factor I Receptor, alpha (IGF1Ra) (BSA & Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human Multi-tissue Tissue MicroArray (Alzheimer's)
NBP2-78122 5 Slides

Human Multi-tissue Tissue MicroArray (Alzheimer's)

Sign In for Pricing
View Details
KCNJ15 (KCNJ14) discontinued
510846 100 µg

KCNJ15 (KCNJ14) discontinued

Sign In for Pricing
View Details
ELISA Kit for Leucine Rich Repeat Containing Protein 3C (LRRC3C)
TRV-0063402-01 24 Tests

ELISA Kit for Leucine Rich Repeat Containing Protein 3C (LRRC3C)

Sign In for Pricing
View Details