Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADTRP protein

This Human ADTRP protein spans the amino acid sequence from region 1-230aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C6orf105

UniProt

Q96IZ2

Expression Region

1-230aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKAL1 Antibody
42-028 0.1 mg

CDKAL1 Antibody

Sign In for Pricing
View Details
PE Mouse anti-Human CD1a mAb
A26903-01 50 Tests

PE Mouse anti-Human CD1a mAb

Sign In for Pricing
View Details
PE Mouse anti-Human CD1a mAb
A26903-02 100 Tests

PE Mouse anti-Human CD1a mAb

Sign In for Pricing
View Details
PE Mouse anti-Human CD1a mAb
A26903-03 200 Tests

PE Mouse anti-Human CD1a mAb

Sign In for Pricing
View Details
PE Mouse anti-Human CD1a mAb
A26903-04 500 Tests

PE Mouse anti-Human CD1a mAb

Sign In for Pricing
View Details
5,​6-​Quinolinediamine
Q701085 100 mg

5,​6-​Quinolinediamine

Sign In for Pricing
View Details