Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADTRP protein

This Human ADTRP protein spans the amino acid sequence from region 1-230aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C6orf105

UniProt

Q96IZ2

Expression Region

1-230aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-O-GlcNAc transferase antibody
SL6996R-01 50 µL

Rabbit Anti-O-GlcNAc transferase antibody

Sign In for Pricing
View Details
Rabbit Anti-O-GlcNAc transferase antibody
SL6996R-02 100 µL

Rabbit Anti-O-GlcNAc transferase antibody

Sign In for Pricing
View Details
PKC zeta (PRKCZ) (NM_002744) Human Tagged Lenti ORF Clone
RC202472L4 10 µg

PKC zeta (PRKCZ) (NM_002744) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
VEGFR1 Lentiviral Activation Particles (m2)
sc-420383-LAC-2 200 µL

VEGFR1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
RUVBL2 Rabbit Polyclonal Antibody
orb574169 100 µL

RUVBL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Caspase 8/CASP8 Antibody Picoband®, Dylight594 Conjugate
A00042-Dylight594 100 µg

Anti-Caspase 8/CASP8 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details