Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADTRP protein

This Human ADTRP protein spans the amino acid sequence from region 1-230aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C6orf105

UniProt

Q96IZ2

Expression Region

1-230aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Secretagogin (SCGN) ELISA Kit
MBS9714403-01 48 Tests

Human Secretagogin (SCGN) ELISA Kit

Sign In for Pricing
View Details
Human Secretagogin (SCGN) ELISA Kit
MBS9714403-02 96 Tests

Human Secretagogin (SCGN) ELISA Kit

Sign In for Pricing
View Details
Human Secretagogin (SCGN) ELISA Kit
MBS9714403-03 5x 96 Tests

Human Secretagogin (SCGN) ELISA Kit

Sign In for Pricing
View Details
FLRG CRISPR Activation Plasmid (h)
sc-406439-ACT 20 µg

FLRG CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Mouse PC3 ELISA Kit
EMP0054 96 Tests

Mouse PC3 ELISA Kit

Sign In for Pricing
View Details
Chicken Neural cell adhesion molecule 1 (NCAM1) ELISA Kit
AE31623CH-01 48 Tests

Chicken Neural cell adhesion molecule 1 (NCAM1) ELISA Kit

Sign In for Pricing
View Details