Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ALPI protein

This Human ALPI protein spans the amino acid sequence from region 20-503aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P09923

Expression Region

20-503aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK7 Protein (N-GST, Human)
P527061 100 µg

NEK7 Protein (N-GST, Human)

Sign In for Pricing
View Details
Zhx1 3'UTR Luciferase Stable Cell Line
TU223862 1.0 mL

Zhx1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SHC2 Antibody
DF4506-01 100 µL

SHC2 Antibody

Sign In for Pricing
View Details
SHC2 Antibody
DF4506-02 200 µL

SHC2 Antibody

Sign In for Pricing
View Details
Phospho-CDK6 (Tyr13) Rabbit Polyclonal Antibody (PE)
orb505787 100 µL

Phospho-CDK6 (Tyr13) Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
ATG5 Antibody
orb751342-01 20 µg

ATG5 Antibody

Sign In for Pricing
View Details