Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ALPI protein

This Human ALPI protein spans the amino acid sequence from region 20-503aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P09923

Expression Region

20-503aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Trappc13 Pre-designed siRNA Set A
SI215118A 1 Each

Rat Trappc13 Pre-designed siRNA Set A

Sign In for Pricing
View Details
DAXX Antibody
MBS7134207-01 0.05 mL

DAXX Antibody

Sign In for Pricing
View Details
DAXX Antibody
MBS7134207-02 0.1 mL

DAXX Antibody

Sign In for Pricing
View Details
DAXX Antibody
MBS7134207-03 5x 0.1 mL

DAXX Antibody

Sign In for Pricing
View Details
Goat anti-Dennd4c Antibody
orb125129 100 µg

Goat anti-Dennd4c Antibody

Sign In for Pricing
View Details
TRNA wybutosine-synthesizing protein 1 homolog B (TYW1B) Human ELISA Kit
H9007 96 Tests

TRNA wybutosine-synthesizing protein 1 homolog B (TYW1B) Human ELISA Kit

Sign In for Pricing
View Details