Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Influenza A virus Matrix protein 2 protein

This Influenza A virus Matrix protein 2 protein spans the amino acid sequence from region 44-97aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proton channel protein M2

UniProt

P06821

Expression Region

44-97aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DRLFFKCIYRRFKYGLKGGPSTEGVPKSMREEYRKEQQSAVDADDGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3'-Dehydrolutein (~90%)
TRC-D229755-25MG 25 mg

3'-Dehydrolutein (~90%)

Sign In for Pricing
View Details
RSPO1 Mouse Monoclonal Antibody [Clone ID: 7A6]
AM06311SU-N 100 µL

RSPO1 Mouse Monoclonal Antibody [Clone ID: 7A6]

Sign In for Pricing
View Details
HEPC (HAMP) (NM_021175) Human Recombinant Protein
TP304620M 100 µg

HEPC (HAMP) (NM_021175) Human Recombinant Protein

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF594 conjugate, 0.1mg/mL
BNC942556-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCP1 eta (CCT7) (NM_001166284) Human Over-expression Lysate
LY431399 100 µg

TCP1 eta (CCT7) (NM_001166284) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB527514 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details