Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PS/HR protein

This PS/HR protein spans the amino acid sequence from region 18-279aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plaque-size/host range protein

UniProt

Q01227

Expression Region

18-279aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Vimentin (VIM)
CSB-EP025857HU-01 20 µg

Recombinant Human Vimentin (VIM)

Sign In for Pricing
View Details
Recombinant Human Vimentin (VIM)
CSB-EP025857HU-02 100 µg

Recombinant Human Vimentin (VIM)

Sign In for Pricing
View Details
Recombinant Human Vimentin (VIM)
CSB-EP025857HU-03 1 mg

Recombinant Human Vimentin (VIM)

Sign In for Pricing
View Details
C6orf223 Protein Vector (Human) (pPM-C-His)
PV006712 500 ng

C6orf223 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
mmu-miR-6973b-3p Primers
MPM01760 150 µL / 10 µM

mmu-miR-6973b-3p Primers

Sign In for Pricing
View Details
Duostatin 5
orb1944690-01 1 mg

Duostatin 5

Sign In for Pricing
View Details