Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ArnT protein

This arnT protein spans the amino acid sequence from region 429-551aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4-amino-4-deoxy-L-arabinose lipid A transferase Lipid IV (A) 4-amino-4-deoxy-L-arabinosyltransferase Undecaprenyl phosphate-alpha-L-Ara4N transferase

UniProt

B5XTL1

Expression Region

429-551aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Klebsiella pneumoniae (strain 342)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RVIDSKQPQFLVDIVSESLQPSRYVLTNNVGIAGGLAWELKRSDIIMFDKQGELKYGLDWPDAQGSFVSQAGFADWLATHRQQGPVSLVLLMDKGESMVDLPLPKPDNAYELGRVVFLQYLPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Tryptophan hydroxylase 2 Antibody
NBP1-77556SS 0.025 mL

Rabbit Polyclonal Tryptophan hydroxylase 2 Antibody

Sign In for Pricing
View Details
Scp2 (NM_011327) Mouse Recombinant Protein
TP508708 20 µg

Scp2 (NM_011327) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant HPV B19 VP2/Coat protein VP2 Protein, N-His
AP98287 50 µg

Recombinant HPV B19 VP2/Coat protein VP2 Protein, N-His

Sign In for Pricing
View Details
Os02g0690500 Antibody
orb840318 2 mg

Os02g0690500 Antibody

Sign In for Pricing
View Details
COX2 (PTGS2, Prostaglandin G/H Synthase 2, Cyclooxygenase-2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, Prostaglandin-endoperoxide Synthase 2) (MaxLight 650)
MBS6374486-01 0.1 mL

COX2 (PTGS2, Prostaglandin G/H Synthase 2, Cyclooxygenase-2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, Prostaglandin-endoperoxide Synthase 2) (MaxLight 650)

Sign In for Pricing
View Details
COX2 (PTGS2, Prostaglandin G/H Synthase 2, Cyclooxygenase-2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, Prostaglandin-endoperoxide Synthase 2) (MaxLight 650)
MBS6374486-02 5x 0.1 mL

COX2 (PTGS2, Prostaglandin G/H Synthase 2, Cyclooxygenase-2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, Prostaglandin-endoperoxide Synthase 2) (MaxLight 650)

Sign In for Pricing
View Details