Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli stcE protein

This E. coli stcE protein spans the amino acid sequence from region 296-551aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mucinase Neutral zinc metalloprotease StcE Secreted protease of C1 esterase inhibitor from EHEC

UniProt

O82882

Expression Region

296-551aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELLLHTIDIGMLTTPRDRFDFAKDKEAHREYFQTIPVSRMIVNNYAPLHLKEVMLPTGELLTDMDPGNGGWHSGTMRQRIGKELVSHGIDNANYGLNSTAGLGENSHPYVVAQLAAHNSRGNYANGIQVHGGSGGGGIVTLDSTLGNEFSHEVGHNYGLGHYVDGFKGSVHRSAENNNSTWGWDGDKKRFIPNFYPSQTNEKSCLNNQCQEPFDGHKFGFDAMAGGSPFSAANRFTMYTPNSSAIIQRFFENKAVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zileuton sodium
orb1704950-01 5 mg

Zileuton sodium

Sign In for Pricing
View Details
Zileuton sodium
orb1704950-02 10 mg

Zileuton sodium

Sign In for Pricing
View Details
LMTK3 (lemur Tyrosine Kinase 3, KIAA1883, LMR3, TYKLM3) (AP) discontinued
248241-AP 100 µL

LMTK3 (lemur Tyrosine Kinase 3, KIAA1883, LMR3, TYKLM3) (AP) discontinued

Sign In for Pricing
View Details
Mmu-miR-7024-5p miRNA Antagomir
orb1912204-01 10 nmol

Mmu-miR-7024-5p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-7024-5p miRNA Antagomir
orb1912204-02 20 nmol

Mmu-miR-7024-5p miRNA Antagomir

Sign In for Pricing
View Details
Bovine Uncharacterized Protein C4orf49 (C4ORF49) ELISA Kit
MBS9921134-01 48 Well

Bovine Uncharacterized Protein C4orf49 (C4ORF49) ELISA Kit

Sign In for Pricing
View Details