Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNK protein

This Human IFNK protein spans the amino acid sequence from region 28-207aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9P0W0

Expression Region

28-207aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKZF5 Rabbit Polyclonal Antibody (Biotin)
orb2137244 100 µL

IKZF5 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Dmap1 3'UTR GFP Stable Cell Line
TU155201 1.0 mL

Dmap1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Porcine COL6α1 (Collagen Type VI Alpha 1) ValidElisa Kit
EK344357 96 Well

Porcine COL6α1 (Collagen Type VI Alpha 1) ValidElisa Kit

Sign In for Pricing
View Details
Porcine Butyrylcholinesterase ELISA Kit
MBS085860-01 48 Well

Porcine Butyrylcholinesterase ELISA Kit

Sign In for Pricing
View Details
Porcine Butyrylcholinesterase ELISA Kit
MBS085860-02 96 Well

Porcine Butyrylcholinesterase ELISA Kit

Sign In for Pricing
View Details
Porcine Butyrylcholinesterase ELISA Kit
MBS085860-03 5x 96 Well

Porcine Butyrylcholinesterase ELISA Kit

Sign In for Pricing
View Details