Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HPRT1 protein

This Human HPRT1 protein spans the amino acid sequence from region 2-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P00492

Expression Region

2-218aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-12/IL-35 p35 Antibody (B-T21) [DyLight 755]
NBP3-14604IR 0.1 mL

Mouse Monoclonal IL-12/IL-35 p35 Antibody (B-T21) [DyLight 755]

Sign In for Pricing
View Details
Phospho-BRAF (Thr401) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-5224R-BF488 100 µL

Phospho-BRAF (Thr401) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal CD74 Antibody (CerCLIP.1) [DyLight 350]
NBP1-19249UV 0.2 mL

Mouse Monoclonal CD74 Antibody (CerCLIP.1) [DyLight 350]

Sign In for Pricing
View Details
MRPL11 (FITC)
569069-01 50 µg

MRPL11 (FITC)

Sign In for Pricing
View Details
MRPL11 (FITC)
569069-02 100 µg

MRPL11 (FITC)

Sign In for Pricing
View Details
Tert-Butyl (3S,4R) -4-amino-3-methoxypiperidine-1-carboxylate hydrochloride
OR1062199-01 100 mg

Tert-Butyl (3S,4R) -4-amino-3-methoxypiperidine-1-carboxylate hydrochloride

Sign In for Pricing
View Details