Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SARS coronavirus Spike glycoprotein (S) protein

This Human SARS coronavirus Spike glycoprotein (S) protein spans the amino acid sequence from region 306-527aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P59594

Expression Region

306-527aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Severe acute respiratory syndrome coronavirus (SARS-CoV)

Field of Research

Infectious Disease & Virology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml.2Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2, the EC50 is 7.941-10.49 ng/ml.

Form

Lyophilized powder

Molecular Weight

30 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

SARS-CoV-2 Related Proteins

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAV3, NT (Caveolin-3, M-caveolin) (Biotin)
MBS6467776-01 0.2 mL

CAV3, NT (Caveolin-3, M-caveolin) (Biotin)

Sign In for Pricing
View Details
CAV3, NT (Caveolin-3, M-caveolin) (Biotin)
MBS6467776-02 5x 0.2 mL

CAV3, NT (Caveolin-3, M-caveolin) (Biotin)

Sign In for Pricing
View Details
Recombinant Human RHPN1 Protein
E30P67765A 50 µg

Recombinant Human RHPN1 Protein

Sign In for Pricing
View Details
Gpc3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4548004 1.0 µg DNA

Gpc3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rat Anti-Sperm Anti-body (AsAb) ELISA Kit
NSL0775r 96 Tests

Rat Anti-Sperm Anti-body (AsAb) ELISA Kit

Sign In for Pricing
View Details
Polyclonal ERP29 Antibody
APR15877G 0.05mg

Polyclonal ERP29 Antibody

Sign In for Pricing
View Details