Human SARS coronavirus Spike glycoprotein (S) protein
This Human SARS coronavirus Spike glycoprotein (S) protein spans the amino acid sequence from region 306-527aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
UniProt
P59594
Expression Region
306-527aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Mammalian cell
Origin
Severe acute respiratory syndrome coronavirus (SARS-CoV)
Field of Research
Infectious Disease & Virology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
1Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml.2Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2, the EC50 is 7.941-10.49 ng/ml.
Form
Lyophilized powder
Molecular Weight
30 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
SARS-CoV-2 Related Proteins
Preservative
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
AA Sequence
RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15382987 1 Vial
Lentiviral human ZNF468 sgRNA gene knockout kit - Lentiviral human ZNF468 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 
GIL02-6X500ML 6x 500 mL
Supplemented Grace's / Hink's TNM-FH Insect Medium With 3330 mg/L Yeastolate, 3330 mg/L Lactalbumin hydrolysate and L-Glutamine
Sign In for Pricing
View Details 
