What is the catalog number for Human SARS coronavirus Spike glycoprotein (S) protein?

The catalog number for Human SARS coronavirus Spike glycoprotein (S) protein is orb668866.

What sizes are available for Human SARS coronavirus Spike glycoprotein (S) protein?

Human SARS coronavirus Spike glycoprotein (S) protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human SARS coronavirus Spike glycoprotein (S) protein come in?

Human SARS coronavirus Spike glycoprotein (S) protein is available in 3 different pack sizes.

Human SARS coronavirus Spike glycoprotein (S) protein

Q: Is Human SARS coronavirus Spike glycoprotein (S) protein in stock?

Human SARS coronavirus Spike glycoprotein (S) protein is currently made to order / not held in immediate stock. Contact us for lead time.

This Human SARS coronavirus Spike glycoprotein (S) protein spans the amino acid sequence from region 306-527aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P59594

Expression Region

306-527aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Severe acute respiratory syndrome coronavirus (SARS-CoV)

Field of Research

Infectious Disease & Virology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml.2Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2, the EC50 is 7.941-10.49 ng/ml.

Form

Lyophilized powder

Molecular Weight

30 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

SARS-CoV-2 Related Proteins

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF