Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine Nc-DigChim-324430 protein

This product spans the sequence region 1-201aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Expression Region

1-201aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSDDDKGQEDLNMIVMKQLGEVRRFFTEDHLGRNVTKQLKEMIAIAKVIRQRIRKSLGEYLKGLENEEFPKCDGNSTKKEIEFIHNWFFHDDPIGNQIAQLAKDWKVAMLKAKGEIRASLAEYCRGLKNKTAVDVPADDKGQEDLKKKMMKHLGEVRRFFREDPLGQKIIDQFQEMIAIAKVIRQRIRKSLGEYLKGLENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Npas2 (BC109166) Mouse Tagged ORF Clone Lentiviral Particle
MR221661L3V 200 µL

Npas2 (BC109166) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Arthrobacter chlorophenolicus Protoheme IX farnesyltransferase (ctaB), partial
MBS1080315-01 1 mg (E-Coli)

Recombinant Arthrobacter chlorophenolicus Protoheme IX farnesyltransferase (ctaB), partial

Sign In for Pricing
View Details
Recombinant Arthrobacter chlorophenolicus Protoheme IX farnesyltransferase (ctaB), partial
MBS1080315-02 1 mg (Yeast)

Recombinant Arthrobacter chlorophenolicus Protoheme IX farnesyltransferase (ctaB), partial

Sign In for Pricing
View Details
Vmn2r55 AAV siRNA Pooled Vector
49799164 1.0 µg

Vmn2r55 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human Alanine--glyoxylate aminotransferase 2, mitochondrial (AGXT2) ELISA Kit
MBS2805526-01 48 Tests

Human Alanine--glyoxylate aminotransferase 2, mitochondrial (AGXT2) ELISA Kit

Sign In for Pricing
View Details
Human Alanine--glyoxylate aminotransferase 2, mitochondrial (AGXT2) ELISA Kit
MBS2805526-02 96 Tests

Human Alanine--glyoxylate aminotransferase 2, mitochondrial (AGXT2) ELISA Kit

Sign In for Pricing
View Details