Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine Nc-DigChim-324430 protein

This product spans the sequence region 1-201aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Expression Region

1-201aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSDDDKGQEDLNMIVMKQLGEVRRFFTEDHLGRNVTKQLKEMIAIAKVIRQRIRKSLGEYLKGLENEEFPKCDGNSTKKEIEFIHNWFFHDDPIGNQIAQLAKDWKVAMLKAKGEIRASLAEYCRGLKNKTAVDVPADDKGQEDLKKKMMKHLGEVRRFFREDPLGQKIIDQFQEMIAIAKVIRQRIRKSLGEYLKGLENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Hordeum vulgare ATP synthase subunit a, chloroplastic (atpI), partial
MBS7063323 Inquire

Recombinant Hordeum vulgare ATP synthase subunit a, chloroplastic (atpI), partial

Sign In for Pricing
View Details
Fish Dynamin-Like 120kDa Protein, Mitochondrial (OPA1) ELISA Kit
MBS9379017 Inquire

Fish Dynamin-Like 120kDa Protein, Mitochondrial (OPA1) ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-Human Alix Polyclonal Antibody
EXA-0822-X246 50 µg

Mouse Anti-Human Alix Polyclonal Antibody

Sign In for Pricing
View Details
Taurine chloramine
orb2564528-01 10 mg

Taurine chloramine

Sign In for Pricing
View Details
Taurine chloramine
orb2564528-02 50 mg

Taurine chloramine

Sign In for Pricing
View Details
ASMEPM-37X230MM-ISOPROPYL ALCOHOL Pipe Markers for Other Liquids
312900 3 Card (3 Marker (s) x 1 Pack)

ASMEPM-37X230MM-ISOPROPYL ALCOHOL Pipe Markers for Other Liquids

Sign In for Pricing
View Details