Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human YWHAZ protein

This Human YWHAZ protein spans the amino acid sequence from region 1-245 aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein kinase C inhibitor protein 1 (KCIP-1)

UniProt

P63104

Expression Region

1-245 aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZRANB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A10]
TA810024AM 100 µL

ZRANB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A10]

Sign In for Pricing
View Details
Mouse Psmd4 activation kit by CRISPRa
GA203432 1 Kit

Mouse Psmd4 activation kit by CRISPRa

Sign In for Pricing
View Details
AATOM™ 620 NHS ester
70261-AAT 1 mg

AATOM™ 620 NHS ester

Sign In for Pricing
View Details
N-Cyclohexyl-13C6-1,3-benzothiazol-2-amine
TRC-A621799-5MG 5 mg

N-Cyclohexyl-13C6-1,3-benzothiazol-2-amine

Sign In for Pricing
View Details
Alpha-Cellulose (powdered)
TRC-C459200-50G 50 g

Alpha-Cellulose (powdered)

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS639239 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details