Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EGLN1 protein

This Human EGLN1 protein spans the amino acid sequence from region 177-426aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2) (HIF-prolyl hydroxylase 2) (HPH-2) (Prolyl hydroxylase domain-containing protein 2) (PHD2) (SM-20) (C1orf12) (PNAS-118) (PNAS-137)

UniProt

Q9GZT9

Expression Region

177-426aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Hepatocyte Growth Factor Activator (HGFAC)
TRV-0024763-01 200 µL

FITC-Linked Polyclonal Antibody to Hepatocyte Growth Factor Activator (HGFAC)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Hepatocyte Growth Factor Activator (HGFAC)
TRV-0024763-02 1 mL

FITC-Linked Polyclonal Antibody to Hepatocyte Growth Factor Activator (HGFAC)

Sign In for Pricing
View Details
ASB4
555678-01 50 µg

ASB4

Sign In for Pricing
View Details
ASB4
555678-02 100 µg

ASB4

Sign In for Pricing
View Details
TTC27 Human shRNA Plasmid Kit (Locus ID 55622)
TR300757 1 Kit

TTC27 Human shRNA Plasmid Kit (Locus ID 55622)

Sign In for Pricing
View Details
LHPL3, CT (LHFPL3, LHFPL4, Lipoma HMGIC fusion partner-like 3 protein) (MaxLight 490)
MBS6315982-01 0.1 mL

LHPL3, CT (LHFPL3, LHFPL4, Lipoma HMGIC fusion partner-like 3 protein) (MaxLight 490)

Sign In for Pricing
View Details