Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Desmoglein 2 protein

This Human Desmoglein 2 protein spans the amino acid sequence from region 50-609aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ARVC 10; ARVC10; ARVD 10; ARVD10; Cadherin family member 5; CDHF 5; CDHF5; CMD1BB; Desmoglein 2; Desmoglein-2; Desmoglein2; DSG 2; DSG2; DSG2_HUMAN; HDGC; HDGC included; Human Desmoglein colon; MGC117034; MGC117036; MGC117037

UniProt

Q14126

Expression Region

50-609aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Disease, Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid: Tris-based buffer, 50% glycerol

Molecular Weight

67.5 kDa

Storage Conditions

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AWITAPVALREGEDLSKKNPIAKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREETPFFLLTGYALDAR GNNVEKPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYRIVSLEPAYPPVFYLNKDTG EIYTTSVTLDREEHSSYTLTVEARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGMVEENQVNVEVTRIKVFDADE IGSDNWLANFTFASGNEGGYFHIETDAQTNEGIVTLIKEVDYEEMKNLDFSVIVANKAAFHKSIRSKYKPTPIPIKVKVKNVKE GIHFKSSVISIYVSESMDRSSKGQIIGNFQAFDEDTGLPAHARYVKLEDRDNWISVDSVTSEIKLAKLPDFESRYVQNGTYTVK IVAISEDYPRKTITGTVLINVEDINDNCPTLIEPVQTICHDAEYVNVTAEDLDGHPNSGPFSFSVIDKPPGMAEKWKIARQESTS VLLQQSEKKLGRSEIQFLISDNQGFSCPEKQVLTLTVCECLHGSGCREAQHDSYVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human LIPN Polyclonal Antibody
HB519014-01 50 µg

Anti-Human LIPN Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human LIPN Polyclonal Antibody
HB519014-02 100 µg

Anti-Human LIPN Polyclonal Antibody

Sign In for Pricing
View Details
FAS (Tumor Necrosis Factor Receptor Superfamily Member 6, TNFRSF6, Apo-1 Antigen, Apoptosis-mediating Surface Antigen FAS, FASLG Receptor, CD95, APT1, FAS1, TNFRSF6) (MaxLight 405)
MBS6190102-01 0.1 mL

FAS (Tumor Necrosis Factor Receptor Superfamily Member 6, TNFRSF6, Apo-1 Antigen, Apoptosis-mediating Surface Antigen FAS, FASLG Receptor, CD95, APT1, FAS1, TNFRSF6) (MaxLight 405)

Sign In for Pricing
View Details
FAS (Tumor Necrosis Factor Receptor Superfamily Member 6, TNFRSF6, Apo-1 Antigen, Apoptosis-mediating Surface Antigen FAS, FASLG Receptor, CD95, APT1, FAS1, TNFRSF6) (MaxLight 405)
MBS6190102-02 5x 0.1 mL

FAS (Tumor Necrosis Factor Receptor Superfamily Member 6, TNFRSF6, Apo-1 Antigen, Apoptosis-mediating Surface Antigen FAS, FASLG Receptor, CD95, APT1, FAS1, TNFRSF6) (MaxLight 405)

Sign In for Pricing
View Details
WRB Rabbit Polyclonal Antibody (Cy3)
orb987314 100 µL

WRB Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Anti-Notch1 Antibody Picoband® (FITC Conjugate)
A00033-2-FITC 100 µg/Vial

Anti-Notch1 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details