Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal LqqIT1 protein

This Animal LqqIT1 protein spans the amino acid sequence from region 1-70aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insect toxin 1 (LqqIT1')

UniProt

P19856

Expression Region

1-70aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KKNGYAVDSSGKAPECLLSNYCYNECTKVHYADKGYCCLLSCYCVGLSDDKKVLEISDARKKYCDFVTIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF568 conjugate, 0.1mg/mL
BNC683291-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Azabicyclo[2.2.1]heptane
TRC-A795330-25MG 25 mg

2-Azabicyclo[2.2.1]heptane

Sign In for Pricing
View Details
Mouse Mdfi activation kit by CRISPRa
GA202618 1 Kit

Mouse Mdfi activation kit by CRISPRa

Sign In for Pricing
View Details
CD70 Mouse Monoclonal Antibody [Clone ID: OTI5D8]
CF813221 100 µg

CD70 Mouse Monoclonal Antibody [Clone ID: OTI5D8]

Sign In for Pricing
View Details
MTOR Rabbit Polyclonal Antibody
AP06628PU-N 100 µg

MTOR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Crude Sophora japonica (Pagoda Tree) -SJA-20mg
L-2900-20 20 mg

Crude Sophora japonica (Pagoda Tree) -SJA-20mg

Sign In for Pricing
View Details