Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal LqqIT1 protein

This Animal LqqIT1 protein spans the amino acid sequence from region 1-70aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insect toxin 1 (LqqIT1')

UniProt

P19856

Expression Region

1-70aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KKNGYAVDSSGKAPECLLSNYCYNECTKVHYADKGYCCLLSCYCVGLSDDKKVLEISDARKKYCDFVTIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Serine
TRC-S270995-25G 25 g

L-Serine

Sign In for Pricing
View Details
Melanoma gp100 (PMEL) (PMEL17 / SILV) Mouse Monoclonal Antibody [Clone ID: HMB45]
AM33241PU-T 20 µg

Melanoma gp100 (PMEL) (PMEL17 / SILV) Mouse Monoclonal Antibody [Clone ID: HMB45]

Sign In for Pricing
View Details
Suppressor of Ty 4 homolog 1 (SUPT4H1) (NM_003168) Human Over-expression Lysate
LY418857 100 µg

Suppressor of Ty 4 homolog 1 (SUPT4H1) (NM_003168) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Tolyl-d4-sulfonamide
TRC-T536632-10MG 10 mg

4-Tolyl-d4-sulfonamide

Sign In for Pricing
View Details
Yaf2 (BC002192) Mouse Tagged ORF Clone
MG201598 10 µg

Yaf2 (BC002192) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD80 (B7-1) (C80/2723), CF405S conjugate, 0.1mg/mL
BNC042723-500 1x 500 µL

CD80 (B7-1) (C80/2723), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details