Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal LqqIT1 protein

This Animal LqqIT1 protein spans the amino acid sequence from region 1-70aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insect toxin 1 (LqqIT1')

UniProt

P19856

Expression Region

1-70aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KKNGYAVDSSGKAPECLLSNYCYNECTKVHYADKGYCCLLSCYCVGLSDDKKVLEISDARKKYCDFVTIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Pancreas
CB521570 1 Block

Frozen Tissue Blocks, Pancreas

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565843 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
MEST (NM_002402) Human Over-expression Lysate
LC419353 20 µg

MEST (NM_002402) Human Over-expression Lysate

Sign In for Pricing
View Details
Sobp Mouse Gene Knockout Kit (CRISPR)
KN516453 1 Kit

Sobp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Col9a1 activation kit by CRISPRa
GA200826 1 Kit

Mouse Col9a1 activation kit by CRISPRa

Sign In for Pricing
View Details
Hexokinase II Rabbit Polyclonal Antibody
HA500186 100 µL

Hexokinase II Rabbit Polyclonal Antibody

Sign In for Pricing
View Details