Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal LqqIT1 protein

This Animal LqqIT1 protein spans the amino acid sequence from region 1-70aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insect toxin 1 (LqqIT1')

UniProt

P19856

Expression Region

1-70aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KKNGYAVDSSGKAPECLLSNYCYNECTKVHYADKGYCCLLSCYCVGLSDDKKVLEISDARKKYCDFVTIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAF-FM
16296-AAT 1 mg

DAF-FM

Sign In for Pricing
View Details
DHRS7 Rabbit Polyclonal Antibody
TA370136 100 µL

DHRS7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF640R conjugate, 0.1mg/mL
BNC400845-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-(4-Chlorophenyl)phenylacetic acid
TRC-C428210-250MG 250 mg

4-(4-Chlorophenyl)phenylacetic acid

Sign In for Pricing
View Details
A1BG (NM_130786) Human Recombinant Protein
TP321406 20 µg

A1BG (NM_130786) Human Recombinant Protein

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10 + VWF635), CF405S conjugate, 0.1mg/mL
BNC040646-100 1x 100 µL

Von Willebrand Factor (3E2D10 + VWF635), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details