Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Tz1 protein

This Animal Tz1 protein spans the amino acid sequence from region 21-84aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PT-beta NaTx14.1

UniProt

Q2NME3

Expression Region

21-84aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Tityus zulianus (Venezuelan scorpion)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KDGYLVGNDGCKYSCFTRPGTYCANECSRVKGKDGYCYAWMACYCYSMPNWVKTWDRATNRCGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4933409K07Rik (NM_178649) Mouse Untagged Clone
MC205243 10 µg

4933409K07Rik (NM_178649) Mouse Untagged Clone

Sign In for Pricing
View Details
Mebeverine D6
CS-EO-03670 1 Each

Mebeverine D6

Sign In for Pricing
View Details
Human hsa-miR-130b-5p miRNA Agomir
abx880570-01 5 nmol

Human hsa-miR-130b-5p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-130b-5p miRNA Agomir
abx880570-02 10 nmol

Human hsa-miR-130b-5p miRNA Agomir

Sign In for Pricing
View Details
Human ABRA Protein Lysate
MBS136714-01 0.02 mg

Human ABRA Protein Lysate

Sign In for Pricing
View Details
Human ABRA Protein Lysate
MBS136714-02 5x 0.02 mg

Human ABRA Protein Lysate

Sign In for Pricing
View Details