Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TRAP1 protein

This Human TRAP1 protein spans the amino acid sequence from region 60-308aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TNFR-associated protein 1Tumor necrosis factor type 1 receptor-associated protein , TRAP-1

UniProt

Q12931

Expression Region

60-308aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR56 Antibody
orb2631333 100 µL

GPR56 Antibody

Sign In for Pricing
View Details
LIN28B Antibody
F44237-0.2ML 0.2 mL

LIN28B Antibody

Sign In for Pricing
View Details
Rat C1qB ELISA Kit
E076920 1 Each

Rat C1qB ELISA Kit

Sign In for Pricing
View Details
Rat Serine Protease ELISA Kit
MBS022449-01 48 Well

Rat Serine Protease ELISA Kit

Sign In for Pricing
View Details
Rat Serine Protease ELISA Kit
MBS022449-02 96 Well

Rat Serine Protease ELISA Kit

Sign In for Pricing
View Details
Rat Serine Protease ELISA Kit
MBS022449-03 5x 96 Well

Rat Serine Protease ELISA Kit

Sign In for Pricing
View Details