Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FN1 protein

This Human FN1 protein spans the amino acid sequence from region 1270-1546aa & 1721-2016aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NovoNectin; Fibronectin; FN; Cold-insoluble globulin; CIG; FN; Fibronectin 1

UniProt

P02751

Expression Region

1270-1546aa&1721-2016aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to support cell attachment and spreading when used as a substratum for cell culture is 0.1-0.5 μg/ml.

Form

Lyophilized powder

Molecular Weight

62.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Dimer

Preservative

Lyophilized from a 0.2 μm filtered 12.5 mM Sodium Citrate, 1.25% Sucrose, pH 6.2

AA Sequence

PTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPS&AIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITIS WRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA Antibody, HRP conjugated
CSB-PA607773LB01IER-01 50 µg

HA Antibody, HRP conjugated

Sign In for Pricing
View Details
HA Antibody, HRP conjugated
CSB-PA607773LB01IER-02 100 µg

HA Antibody, HRP conjugated

Sign In for Pricing
View Details
KIF11 Antibody - N-terminal region : Biotin (ARP74963_P050-Biotin)
ARP74963_P050-Biotin 100 µL

KIF11 Antibody - N-terminal region : Biotin (ARP74963_P050-Biotin)

Sign In for Pricing
View Details
SMURF2, NT (E3 Ubiquitin-protein Ligase SMURF2, Smad Ubiquitination Regulatory Factor 2, Ubiquitin-protein Ligase SMURF2, Smad-specific E3 Ubiquitin Ligase 2, hSMURF2) (AP) discontinued
S1014-65E-AP 200 µL

SMURF2, NT (E3 Ubiquitin-protein Ligase SMURF2, Smad Ubiquitination Regulatory Factor 2, Ubiquitin-protein Ligase SMURF2, Smad-specific E3 Ubiquitin Ligase 2, hSMURF2) (AP) discontinued

Sign In for Pricing
View Details
Human Protein Phosphatase 1, Regulatory Subunit 1B (PPP1R1B) ELISA Kit
BSKH64106-01 48 Tests

Human Protein Phosphatase 1, Regulatory Subunit 1B (PPP1R1B) ELISA Kit

Sign In for Pricing
View Details
Human Protein Phosphatase 1, Regulatory Subunit 1B (PPP1R1B) ELISA Kit
BSKH64106-02 96 Tests

Human Protein Phosphatase 1, Regulatory Subunit 1B (PPP1R1B) ELISA Kit

Sign In for Pricing
View Details