Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF9 protein

This Human TNFRSF9 protein spans the amino acid sequence from region 24-186aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD137; ILA; TNFRSF9;4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA

UniProt

Q07011

Expression Region

24-186aa

Tag

C-terminal 6xHis-Fc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human 4-1BB-Fc-His at 2μg/ml can bind Anti-Human CD137 mAb, the ED50 of Anti-Human CD137 mAb is 0.41ug/ml.

Form

Lyophilized powder

Molecular Weight

44 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIM2 Rabbit pAb
E45R22166N 50 ul

PIM2 Rabbit pAb

Sign In for Pricing
View Details
OCIAD2 siRNA (h)
sc-88936 10 µM

OCIAD2 siRNA (h)

Sign In for Pricing
View Details
TAAR2 AAV Vector (Human) (CMV)
46022101 1 µg

TAAR2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Anti-KCTD7 Polyclonal Antibody
TMAB-07964-01 50 μL

Anti-KCTD7 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-KCTD7 Polyclonal Antibody
TMAB-07964-02 100 µL

Anti-KCTD7 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-KCTD7 Polyclonal Antibody
TMAB-07964-03 200 µL

Anti-KCTD7 Polyclonal Antibody

Sign In for Pricing
View Details