Human TNFRSF9 protein
This Human TNFRSF9 protein spans the amino acid sequence from region 24-186aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CD137; ILA; TNFRSF9;4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA
UniProt
Q07011
Expression Region
24-186aa
Tag
C-terminal 6xHis-Fc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human 4-1BB-Fc-His at 2μg/ml can bind Anti-Human CD137 mAb, the ED50 of Anti-Human CD137 mAb is 0.41ug/ml.
Form
Lyophilized powder
Molecular Weight
44 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Extracellular Domain
Preservative
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
AA Sequence
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A04591-1-Cy3 100 µg/Vial
Anti-CREB3L2 Antibody Picoband® Cy3 Conjugated
Sign In for Pricing
View Details 
MBS3802893-01 48 Well
Human Vaccinia Viruses IgM (cowpox) ELISA Kit
Sign In for Pricing
View Details MBS3802893-02 96 Well
Human Vaccinia Viruses IgM (cowpox) ELISA Kit
Sign In for Pricing
View Details MBS3802893-03 5x 96 Well
Human Vaccinia Viruses IgM (cowpox) ELISA Kit
Sign In for Pricing
View Details MBS3802893-04 10x 96 Well
Human Vaccinia Viruses IgM (cowpox) ELISA Kit
Sign In for Pricing
View Details